Web Analysis for Chalkevalleyplayschool - chalkevalleyplayschool.co.uk
Chalke Valley Playschool Broad Chalke - Pre-school Educational setting
chalkevalleyplayschool.co.uk is 1 decade 3 years old. It is a domain having co.uk extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, chalkevalleyplayschool.co.uk is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | 58 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 13,500 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 5 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 2 | Total Images: | 6 |
Google Adsense: | Not Applicable | Google Analytics: | UA-7870337-1 |
Websites Hosted on Same IP (i.e. 199.34.228.77)
FRS HEALTHY ENERGY - Home
POWER YOUR BODY FROM WITHIN: Our scientifically-advanced and patented formula delivers long-lasting, natural energy, improved athletic performance, increased mental function, and immune system support.
Arial Software - Email Marketing Software For Your PC | Newsletters
Email Marketing Software programs you install on your own PC or server, no monthly fees, connects to your database. Newsletters, admin using browser.
HTTP Header Analysis
Date: Wed, 25 Dec 2019 10:51:46 GMT
Server: Apache
Vary: X-W-SSL,Accept-Encoding,User-Agent
Cache-Control: private
ETag: W/"6e2626cb2b289238fca7612188d39fa8-gzip"
Content-Encoding: gzip
X-Host: pages41.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Content-Length: 13666
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.livedns.co.uk | 217.160.81.244 | Germany | |
ns2.livedns.co.uk | 217.160.82.244 | Germany | |
ns3.livedns.co.uk | 185.132.35.244 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
chalkevalleyplayschool.co.uk | A | 3600 |
IP: 199.34.228.77 |
chalkevalleyplayschool.co.uk | NS | 3600 |
Target: ns1.livedns.co.uk |
chalkevalleyplayschool.co.uk | NS | 3600 |
Target: ns2.livedns.co.uk |
chalkevalleyplayschool.co.uk | NS | 3600 |
Target: ns3.livedns.co.uk |
chalkevalleyplayschool.co.uk | SOA | 3600 |
MNAME: ns1.livedns.co.uk RNAME: admin.chalkevalleyplayschool.co.uk Serial: 1569327555 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
chalkevalleyplayschool.co.uk | MX | 3600 |
Priority: 10 Target: mailserver.chalkevalleyplayschool.co.uk |
Full WHOIS Lookup
chalkevalleyplayschool.co.uk
Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 25-Sep-2019
Registrar:
GoDaddy.com, LLC. [Tag = GODADDY]
URL: http://uk.godaddy.com
Relevant dates:
Registered on: 03-Apr-2011
Expiry date: 03-Apr-2021
Last updated: 31-Oct-2019
Registration status:
Registered until expiry date.
Name servers:
ns1.livedns.co.uk 217.160.81.244
ns2.livedns.co.uk 217.160.82.244
ns3.livedns.co.uk 217.160.83.244
WHOIS lookup made at 10:52:10 25-Dec-2019
--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2019.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.